PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009801470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 314aa    MW: 34793.9 Da    PI: 9.7155
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009801470.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.11.2e-32185241158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     d p+YVNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh hA++R RgsgGrF
  XP_009801470.1 185 DGPVYVNAKQYHGILRRRQMRAKLEAQNKL-VKARKPYLHESRHLHAVKRVRGSGGRF 241
                     57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.1E-37183244IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.033184244IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.3E-24187209IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-27187241IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860189209IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.3E-24218241IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAVRAQALPN RSLEQTSTCF VPHFAVNSST WWSSNEVQSS QSLPKNLTSE VVFQPPPCQQ  60
MKPLGLGLQG DDSYSTQSNS NSPLEVTALG KTGSRDQCAS SGSVHDESYK RNKQAQIKTN  120
PFIRYPEYPT DCSQSEMAHS ISHAPFGYSD PYLSGFYAAY GPHVFPQMIG IAPARVPLPL  180
DLAEDGPVYV NAKQYHGILR RRQMRAKLEA QNKLVKARKP YLHESRHLHA VKRVRGSGGR  240
FLSTKKLQES IPNDLNSSQD LVTREAHISS FLSVRQDAAH NSVIFQQQQH DHRASSLSSH  300
MAVSMQSSRS SGIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-21187245462NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801470.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLK4DBZ34e-99K4DBZ3_SOLLC; Uncharacterized protein
STRINGSolyc12g009050.1.11e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA50092338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.15e-45nuclear factor Y, subunit A5